PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G144400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 212aa    MW: 24088.3 Da    PI: 11.3345
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G144400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.11.3e-108441248
                        HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +v++++ +G g W+  ar  g++Rt+k+c++rw++yl
  Sevir.3G144400.1.p  8 IVNYIAAHGEGAWNNLARAAGLNRTGKSCRLRWLNYL 44
                        7999*******************************97 PP

2Myb_DNA-binding551.9e-175093146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        rg++T+eE+e++v++ +++G++ W++Ia++++ gRt++++k++w++
  Sevir.3G144400.1.p 50 RGNMTAEEQERIVQLQARWGNK-WSRIAKHLP-GRTDNEVKNFWRT 93
                        89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.771144IPR017930Myb domain
SuperFamilySSF466895.74E-23791IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-16851IPR009057Homeodomain-like
CDDcd001671.48E-4844No hitNo description
SMARTSM007171.7846IPR001005SANT/Myb domain
PfamPF002492.3E-8844IPR001005SANT/Myb domain
PROSITE profilePS5129424.4834599IPR017930Myb domain
SMARTSM007176.0E-144997IPR001005SANT/Myb domain
PfamPF002494.2E-155093IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-225298IPR009057Homeodomain-like
CDDcd001674.14E-115293No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MAHARHVIVN YIAAHGEGAW NNLARAAGLN RTGKSCRLRW LNYLRPDVRR GNMTAEEQER  60
IVQLQARWGN KWSRIAKHLP GRTDNEVKNF WRTKIQQKKH KNKEHSAIET IITVAGVCSG  120
MACKDTPAIT EDQGSSNYSG RTGVTQDYGI VRQQQPNISS AADYLSLRCA WRSHWRWRLG  180
LRSGVPGRVG RELLGHRRRL WTTMQSYQGS S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-1889838127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1209863e-33AC120986.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1781_H11, complete sequence.
GenBankAC1209903e-33AC120990.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0040E06, complete sequence.
GenBankAP0149613e-33AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126133e-33CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699923.11e-119PREDICTED: transcription factor MYB24
TrEMBLK3ZD001e-103K3ZD00_SETIT; Uncharacterized protein
STRINGSi024431m1e-103(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.13e-52myb domain protein 24